DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and NUDT1

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_945187.1 Gene:NUDT1 / 4521 HGNCID:8048 Length:179 Species:Homo sapiens


Alignment Length:121 Identity:33/121 - (27%)
Similarity:50/121 - (41%) Gaps:36/121 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QYLLL---KASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYDEKDLIIYKDTPLTLNYQVQD 79
            |.:||   |..:|:..|:...|.|..||.....|.||.:||:|             ||:: .:..
Human    39 QRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESG-------------LTVD-ALHK 89

  Fly    80 KPKIVIYWLAELRNPCQEPILSEEH---TD-LKWLPKE--EAKQC------VGFKD 123
            ..:||..::.       ||.|.:.|   || ::..|.|  |.:.|      :.|||
Human    90 VGQIVFEFVG-------EPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 33/121 (27%)
NUDT1NP_945187.1 MTH1 29..163 CDD:239519 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.