DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and nudt2

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001006918.1 Gene:nudt2 / 448765 XenbaseID:XB-GENE-1008721 Length:154 Species:Xenopus tropicalis


Alignment Length:146 Identity:70/146 - (47%)
Similarity:96/146 - (65%) Gaps:8/146 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAAGFVIFRR-------LCGE-IQYLLLKASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYD 59
            :|.|.:||||       ..|: |::|||:.|||..||:.|||||||||||.:||||||:||||.|
 Frog     4 RACGLIIFRRCQAGVSAAAGDGIEFLLLQTSYGEHHWTPPKGHVDPGEDDMSTALRETEEEAGLD 68

  Fly    60 EKDLIIYKDTPLTLNYQVQDKPKIVIYWLAELRNPCQEPILSEEHTDLKWLPKEEAKQCVGFKDN 124
            ...:.:.|.....:||.|:::||.|||||||||:......||.||.|.:|||..||.:..|::|.
 Frog    69 SSHISLVKGFCKEMNYNVRNRPKTVIYWLAELRDYTTPVRLSNEHQDYRWLPLGEACKYAGYQDM 133

  Fly   125 QVMIDKFHQMILDQNK 140
            :..:::.||.:|:|.|
 Frog   134 KDTLNEAHQFLLNQKK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 65/137 (47%)
nudt2NP_001006918.1 Ap4A_hydrolase_human_like 2..142 CDD:239520 65/137 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5746
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H896
Inparanoid 1 1.050 140 1.000 Inparanoid score I4393
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1107148at2759
OrthoFinder 1 1.000 - - FOG0004403
OrthoInspector 1 1.000 - - oto102522
Panther 1 1.100 - - LDO PTHR21340
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2399
SonicParanoid 1 1.000 - - X4204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.