DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Datp and DCP2

DIOPT Version :10

Sequence 1:NP_723505.2 Gene:Datp / 318908 FlyBaseID:FBgn0287788 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster


Alignment Length:115 Identity:33/115 - (28%)
Similarity:50/115 - (43%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLKASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYDEKDLIIYKD-TPLTLNYQVQDKPKI 83
            ||:::.:....|..|||.::..||....|.||..||.|:|..|||...| ....:|||...    
  Fly   326 LLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTR---- 386

  Fly    84 VIYWLAELRN-PCQEPILSEEHTDLKWLP--KEEAKQCVGFKDNQVMIDK 130
                |..:|| |          .|.::.|  :.|.|.|..|:.:.:.::|
  Fly   387 ----LYVVRNIP----------MDTQFAPRTRNEIKCCDWFRIDALPVNK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DatpNP_723505.2 NUDIX_Ap4A_Nudt2 1..135 CDD:467534 33/115 (29%)
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 33/115 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.