DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and DCP2

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster


Alignment Length:115 Identity:33/115 - (28%)
Similarity:50/115 - (43%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLKASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYDEKDLIIYKD-TPLTLNYQVQDKPKI 83
            ||:::.:....|..|||.::..||....|.||..||.|:|..|||...| ....:|||...    
  Fly   326 LLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTR---- 386

  Fly    84 VIYWLAELRN-PCQEPILSEEHTDLKWLP--KEEAKQCVGFKDNQVMIDK 130
                |..:|| |          .|.::.|  :.|.|.|..|:.:.:.::|
  Fly   387 ----LYVVRNIP----------MDTQFAPRTRNEIKCCDWFRIDALPVNK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 33/115 (29%)
DCP2NP_001246776.1 DCP2 212..307 CDD:282833
Dcp2p 310..459 CDD:239644 33/115 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.