DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and Nudt5

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001007734.1 Gene:Nudt5 / 361274 RGDID:1359284 Length:219 Species:Rattus norvegicus


Alignment Length:32 Identity:13/32 - (40%)
Similarity:17/32 - (53%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GSFHWSSPKGHVDPGEDDFTTALRETKEEAGY 58
            |.:....|.|.::.||.....||||.:||.||
  Rat    88 GGYCLEFPAGLIEDGESPEAAALRELEEETGY 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 13/32 (41%)
Nudt5NP_001007734.1 Substrate binding, shared with dimeric partner. /evidence=ECO:0000250|UniProtKB:Q9UKK9 46..47
ADPRase_NUDT5 60..207 CDD:239516 13/32 (41%)
Nudix box 97..118 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.