DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and NUDT2

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001152.1 Gene:NUDT2 / 318 HGNCID:8049 Length:147 Species:Homo sapiens


Alignment Length:140 Identity:66/140 - (47%)
Similarity:87/140 - (62%) Gaps:8/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAAGFVIFRRLC-------GEIQYLLLKASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYDE 60
            :|.|.:|||| |       ..|::|||:||.|..||:.|||||:|||||..||||||:||||.:.
Human     4 RACGLIIFRR-CLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEA 67

  Fly    61 KDLIIYKDTPLTLNYQVQDKPKIVIYWLAELRNPCQEPILSEEHTDLKWLPKEEAKQCVGFKDNQ 125
            ..|.|.:.....|||..::|||.|||||||:::...|..||.||...:||..|||.|...||:.:
Human    68 GQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMK 132

  Fly   126 VMIDKFHQMI 135
            ..:.:.||.:
Human   133 AALQEGHQFL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 64/136 (47%)
NUDT2NP_001152.1 Ap4A_hydrolase_human_like 2..140 CDD:239520 64/136 (47%)
Nudix box 43..64 16/20 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6476
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H896
Inparanoid 1 1.050 123 1.000 Inparanoid score I4747
Isobase 1 0.950 - 0 Normalized mean entropy S4140
OMA 1 1.010 - - QHG62350
OrthoDB 1 1.010 - - D1107148at2759
OrthoFinder 1 1.000 - - FOG0004403
OrthoInspector 1 1.000 - - oto88647
orthoMCL 1 0.900 - - OOG6_104771
Panther 1 1.100 - - LDO PTHR21340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2399
SonicParanoid 1 1.000 - - X4204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.