DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and Y92H12BL.5

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_740784.1 Gene:Y92H12BL.5 / 259365 WormBaseID:WBGene00022366 Length:150 Species:Caenorhabditis elegans


Alignment Length:125 Identity:28/125 - (22%)
Similarity:45/125 - (36%) Gaps:21/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EIQYLLLKASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYDEKDLIIYKDTPLTLNYQVQDK 80
            |...||:........|..|.|.::..|.....|.||..||||        .:.|.|......|| 
 Worm    38 ETLVLLVSGGKDGGKWVVPGGGIEKDECAEEAAHRELMEEAG--------VRATILKKIGMFQD- 93

  Fly    81 PKIVIYWLAELRNPCQEPILSEEHTDLK-WLPKEEAKQCVGFK--DNQVMIDKFHQMILD 137
                     ::|....:..|.|...:|: |...|..:|.:...  :.:..:.:.|:.:||
 Worm    94 ---------DVRKHRTQVFLMEVSEELQTWEENEYGRQRIWMNVLEGKEKVKQSHRAMLD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 25/119 (21%)
Y92H12BL.5NP_740784.1 Nudix_Hydrolase_9 25..137 CDD:240024 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.