powered by:
Protein Alignment Apf and ndx-7
DIOPT Version :9
Sequence 1: | NP_723505.2 |
Gene: | Apf / 318908 |
FlyBaseID: | FBgn0051713 |
Length: | 142 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491336.2 |
Gene: | ndx-7 / 183413 |
WormBaseID: | WBGene00003584 |
Length: | 295 |
Species: | Caenorhabditis elegans |
Alignment Length: | 139 |
Identity: | 29/139 - (20%) |
Similarity: | 45/139 - (32%) |
Gaps: | 70/139 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 PKGHVDPGE----DDF-TTALRETKEEAG------------------------------YDE--- 60
|.|.||..: |:| ..|:||..||:| :::
Worm 45 PGGVVDKTDAKLGDEFRIAAVRELFEESGVLSTKNGWQTSANNPDMTSLKADIVNDTSKFEQLSG 109
Fly 61 ---KDLIIYKDTPLT-LNYQ-----------VQDKPKIVIYWLAELRNPCQEPILSEEHTDLKWL 110
.|.:|..||.:| .||. |.|:|.| .:.:.|.::..|:
Worm 110 TICADNLIEWDTFITPANYPRRFLTKFYLMLVDDEPAI--------------DLCTSEMSEYNWI 160
Fly 111 PKEEAKQCV 119
|.|:||
Worm 161 ---EPKECV 166
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.