DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and Nudt1

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_476461.1 Gene:Nudt1 / 117260 RGDID:621080 Length:156 Species:Rattus norvegicus


Alignment Length:43 Identity:16/43 - (37%)
Similarity:21/43 - (48%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QYLLL---KASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAG 57
            |.:||   |..:|:..|:...|.|..||.....|.||..||:|
  Rat    16 QRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGAKRELLEESG 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 16/43 (37%)
Nudt1NP_476461.1 MTH1 6..140 CDD:239519 16/43 (37%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P36639 35..38 0/2 (0%)
Nudix box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00794 37..58 9/20 (45%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P36639 117..120
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.