Protein Alignment Apf and NUDT5

DIOPT Version :9

• Sequence 1: NP_723505.2
• Gene: Apf / 318908
• FlyBaseID: FBgn0051713
• Length: 142
• Species: Drosophila melanogaster
• Sequence 2: NP_054861.2
• Gene: NUDT5 / 11164
• HGNCID: 8052
• Length: 219
• Species: Homo sapiens
• Alignment Length: 32
• Identity: 14/32 - (43%)
• Similarity: 17/32 - (53%)
• Gaps: 0/32 - (0%)

  Fly    27 GSFHWSSPKGHVDPGEDDFTTALRETKEEAGY 58
            |.:....|.|.:|.||.....||||.:||.||
Human    88 GGYCIEFPAGLIDDGETPEAAALRELEEETGY 119

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Apf	NP_723505.2	Ap4A_hydrolase_human_like	1..133	CDD:239520	14/32 (44%)
NUDT5	NP_054861.2	Substrate binding, shared with dimeric partner. /evidence=ECO:0000269|PubMed:17052728, ECO:0000269|PubMed:18462755, ECO:0000269|PubMed:21768126	46..47
		ADPRase_NUDT5	60..207	CDD:239516	14/32 (44%)
		Nudix box	97..118		10/20 (50%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0494
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900