DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and Nudt10

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001026834.1 Gene:Nudt10 / 102954 MGIID:2147931 Length:164 Species:Mus musculus


Alignment Length:60 Identity:21/60 - (35%)
Similarity:30/60 - (50%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKAAGFVIFRRLCGEIQYLLLKASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYDEK 61
            :|.|..:.||.. .|.:.||:.:|.....|..|.|.::|.|:....|:||..||||...|
Mouse    17 KKRAACLCFRSE-REDEVLLVSSSRYPDRWIVPGGGMEPEEEPDGAAVREVYEEAGVKGK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 21/60 (35%)
Nudt10NP_001026834.1 Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 17..19 0/1 (0%)
Nudix_Hydrolase_9 18..137 CDD:240024 21/59 (36%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 38..40 0/1 (0%)
Nudix box 50..71 8/20 (40%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 89..91
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.