DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Sfp33A3

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001162959.1 Gene:Sfp33A3 / 8674115 FlyBaseID:FBgn0259964 Length:99 Species:Drosophila melanogaster


Alignment Length:68 Identity:34/68 - (50%)
Similarity:42/68 - (61%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVLDCLIKEGRSITVEKK 65
            ||.|.||||.|.||||::||:.|   |.|...|.|:|.|:|.||:|.|...|.:|.|..|||.|.
  Fly     1 MRYLPFIAFFLFALLALSVGEEF---CNCNLIYRPLCASNSKTYNNYCEFKCEVKRGSPITVVKW 62

  Fly    66 GRC 68
            .:|
  Fly    63 KQC 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 18/41 (44%)
Sfp33A3NP_001162959.1 KAZAL_FS 26..65 CDD:238052 17/38 (45%)

Return to query results.
Submit another query.