DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Fstl3

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_113557.1 Gene:Fstl3 / 83554 MGIID:1890391 Length:256 Species:Mus musculus


Alignment Length:49 Identity:19/49 - (38%)
Similarity:27/49 - (55%) Gaps:8/49 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SCPCPRNYDP---VCGSDSVTYSNQCVL---DCLIKEGRSITVEKKGRC 68
            :.|||...:|   :||:::|||.:.|.|   .|.:  ||||.|...|.|
Mouse   195 AAPCPVPSNPGQELCGNNNVTYISSCHLRQATCFL--GRSIGVRHPGIC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 18/47 (38%)
Fstl3NP_113557.1 KAZAL <132..165 CDD:197624
KAZAL_FS 169..>229 CDD:412159 12/33 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.