DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Spinkl

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_898946.1 Gene:Spinkl / 77424 MGIID:1924674 Length:90 Species:Mus musculus


Alignment Length:35 Identity:12/35 - (34%)
Similarity:16/35 - (45%) Gaps:1/35 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DPVCGSDSVTYSNQCVLDCLIKEGRSITVEKKGRC 68
            :|||..|..||.|:|.. |:.|....:.....|.|
Mouse    54 NPVCADDRNTYYNECYF-CIEKVVEKLKYRYHGIC 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 11/33 (33%)
SpinklNP_898946.1 KAZAL_FS 48..>74 CDD:238052 9/20 (45%)

Return to query results.
Submit another query.