DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Spink2

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:XP_011247866.1 Gene:Spink2 / 69982 MGIID:1917232 Length:88 Species:Mus musculus


Alignment Length:41 Identity:21/41 - (51%)
Similarity:26/41 - (63%) Gaps:1/41 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CPRNYDPVCGSDSVTYSNQCVLDCLIKE-GRSITVEKKGRC 68
            ||||.:||||:|..||||:|.|...|:| |..|.:.|...|
Mouse    48 CPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 20/39 (51%)
Spink2XP_011247866.1 Kazal_1 40..88 CDD:395004 20/39 (51%)

Return to query results.
Submit another query.