DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and fstl3

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001025282.2 Gene:fstl3 / 557352 ZFINID:ZDB-GENE-050913-111 Length:246 Species:Danio rerio


Alignment Length:49 Identity:18/49 - (36%)
Similarity:25/49 - (51%) Gaps:8/49 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SCPCPR---NYDPVCGSDSVTYSNQCVL---DCLIKEGRSITVEKKGRC 68
            :.|||.   ....:||:|::||.:.|.|   .|.:  ||||.|...|.|
Zfish   188 TAPCPMPMITEQTICGNDNITYQSACHLRRATCFL--GRSIGVRHYGHC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 17/47 (36%)
fstl3NP_001025282.2 KAZAL 111..158 CDD:197624
KAZAL_FS 201..234 CDD:238052 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.