DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and CG32354

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster


Alignment Length:70 Identity:25/70 - (35%)
Similarity:34/70 - (48%) Gaps:18/70 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVLD---CLIKEGRSITVE 63
            ||||  ||.|.....:           |||.::||||||:.||.|.|.|:   |  :..:::.|.
  Fly   596 RCLA--AFQLKGCARI-----------CPREFEPVCGSDNKTYLNDCFLEIENC--RANQTVNVN 645

  Fly    64 KKGRC 68
            ..|.|
  Fly   646 YYGAC 650

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 17/44 (39%)
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:412159
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:412159
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624