DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and LOC4577980

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:XP_001230687.2 Gene:LOC4577980 / 4577980 VectorBaseID:AGAMI1_012281 Length:101 Species:Anopheles gambiae


Alignment Length:42 Identity:16/42 - (38%)
Similarity:25/42 - (59%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CPCPRNYDPVCGSDSVTYSNQCVLDCLIKEGRSITVEKKGRC 68
            |.|||.|.|:|.|:..||:|.|...|..:...:::|:.:.||
Mosquito    50 CACPRTYKPLCASNGQTYNNHCAFKCAKQLNATLSVKAQARC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 14/40 (35%)
LOC4577980XP_001230687.2 None

Return to query results.
Submit another query.