DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Spink6

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001013819.1 Gene:Spink6 / 433180 MGIID:3648654 Length:105 Species:Mus musculus


Alignment Length:57 Identity:20/57 - (35%)
Similarity:29/57 - (50%) Gaps:9/57 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QVFQYSCP--------CPRNYDPVCGSDSVTYSNQCVL-DCLIKEGRSITVEKKGRC 68
            ::||.:|.        |.|..||:||||..||.|:|.. ..|.|....|.::.:|:|
Mouse    49 RLFQINCGEFRDPKVFCTRESDPLCGSDGQTYGNKCAFCKALEKSSGKINLKHRGKC 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 17/50 (34%)
Spink6NP_001013819.1 Kazal_1 61..105 CDD:395004 16/43 (37%)

Return to query results.
Submit another query.