DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Spink4

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:XP_063144220.1 Gene:Spink4 / 408233 RGDID:1303188 Length:150 Species:Rattus norvegicus


Alignment Length:42 Identity:17/42 - (40%)
Similarity:28/42 - (66%) Gaps:3/42 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CPRNYDPVCGSDSVTYSNQCVLDCL--IKEGRSITVEKKGRC 68
            |||:.:.:||:|.:||.|:|.| |:  :|..:.|.:.|.|:|
  Rat   110 CPRSPNLICGTDGLTYENECHL-CVTRMKTKKDIQIMKDGKC 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 16/40 (40%)
Spink4XP_063144220.1 None

Return to query results.
Submit another query.