DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and SPINK6

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_995313.2 Gene:SPINK6 / 404203 HGNCID:29486 Length:80 Species:Homo sapiens


Alignment Length:71 Identity:23/71 - (32%)
Similarity:35/71 - (49%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAFIAFCLSALLAMAVGQV--FQYSCP---CPRNYDPVCGSDSVTYSNQCVL-DCLIKEGRSITV 62
            |:...||....:....|||  .::..|   |.|..:|.||||..||.|:|.. ..::|.|..|::
Human    10 LSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISL 74

  Fly    63 EKKGRC 68
            :..|:|
Human    75 KHPGKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 16/45 (36%)
SPINK6NP_995313.2 Kazal_1 36..80 CDD:395004 16/43 (37%)

Return to query results.
Submit another query.