DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and ZK813.6

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001033579.1 Gene:ZK813.6 / 3896892 WormBaseID:WBGene00044564 Length:251 Species:Caenorhabditis elegans


Alignment Length:46 Identity:16/46 - (34%)
Similarity:23/46 - (50%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SCPCPRNYDPVC---GSDSVTYSNQCVLDCLIKEGRSITVEKKGRC 68
            :|.|....||||   |....||||:||..|..:..:.:.:..:|.|
 Worm    24 TCSCKPEIDPVCVREGPYQYTYSNKCVFQCAQENKKDLVLLYEGSC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 15/44 (34%)
ZK813.6NP_001033579.1 KAZAL 121..169 CDD:197624
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.