DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Spink8

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001100330.1 Gene:Spink8 / 301016 RGDID:1307150 Length:101 Species:Rattus norvegicus


Alignment Length:37 Identity:15/37 - (40%)
Similarity:23/37 - (62%) Gaps:3/37 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DPVCGSDSVTYSNQCVLDC--LIKEGRSITVEKKGRC 68
            :|:|||:.|||:.:|.| |  ::.|.|:|.....|.|
  Rat    61 EPICGSNQVTYNGECHL-CSEILFEDRTIIKVHDGPC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 14/35 (40%)
Spink8NP_001100330.1 KAZAL_PSTI 47..96 CDD:238648 14/35 (40%)

Return to query results.
Submit another query.