DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Spink1

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_036806.1 Gene:Spink1 / 24833 RGDID:3749 Length:79 Species:Rattus norvegicus


Alignment Length:78 Identity:29/78 - (37%)
Similarity:43/78 - (55%) Gaps:19/78 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IAFCLSALLAMAV---------GQVFQYSCP-----CPRNYDPVCGSDSVTYSNQCVLDCL--IK 55
            |.|.||||..:::         |:.  .:||     |||.||||||::.:||.::|.| |.  .|
  Rat     5 IIFLLSALALLSLAGNPPAEVNGKT--PNCPKQIMGCPRIYDPVCGTNGITYPSECSL-CFENRK 66

  Fly    56 EGRSITVEKKGRC 68
            .|.||.::::|.|
  Rat    67 FGTSIHIQRRGTC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 21/48 (44%)
Spink1NP_036806.1 KAZAL_PSTI 38..79 CDD:238648 19/41 (46%)

Return to query results.
Submit another query.