DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and TMEFF2

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_057276.2 Gene:TMEFF2 / 23671 HGNCID:11867 Length:374 Species:Homo sapiens


Alignment Length:55 Identity:18/55 - (32%)
Similarity:26/55 - (47%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MAVGQVFQYSC--PCPRNYDPVCGSDSVTYSNQCVL-DCLIKEGRSITVEKKGRC 68
            :.:|......|  .|..:|.|||||:..:|.|:|.| ....|:...|.|..:|.|
Human    81 LRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 16/44 (36%)
TMEFF2NP_057276.2 KAZAL_FS 95..135 CDD:238052 15/39 (38%)
KAZAL 181..227 CDD:197624
PHA02887 <236..301 CDD:165214
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.