DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Fst

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001288302.1 Gene:Fst / 14313 MGIID:95586 Length:344 Species:Mus musculus


Alignment Length:46 Identity:20/46 - (43%)
Similarity:29/46 - (63%) Gaps:6/46 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CPCPRNYDP-VCGSDSVTYSNQCVL---DCLIKEGRSITVEKKGRC 68
            ||.|.:.:. :||:|.||||:.|.|   .||:  ||||.:..:|:|
Mouse   196 CPEPSSSEQYLCGNDGVTYSSACHLRKATCLL--GRSIGLAYEGKC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 19/44 (43%)
FstNP_001288302.1 FOLN 94..117 CDD:128570
KAZAL 117..164 CDD:197624
FOLN 167..190 CDD:128570
KAZAL 192..239 CDD:197624 19/44 (43%)
KAZAL 270..316 CDD:197624
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..344
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.