DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Fs

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:XP_061499539.1 Gene:Fs / 1276936 VectorBaseID:AGAMI1_012796 Length:720 Species:Anopheles gambiae


Alignment Length:52 Identity:21/52 - (40%)
Similarity:27/52 - (51%) Gaps:11/52 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SC---PCPRNYDP---VCGSDSVTYSNQCVLD---CLIKEGRSITVEKKGRC 68
            ||   .|..:..|   |||:|.:||.:.|.|.   ||  .||:|.|..:|||
Mosquito   571 SCGVAECRADRSPKSVVCGTDGITYPSICELKRQACL--NGRAIPVAYRGRC 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 19/50 (38%)
FsXP_061499539.1 None

Return to query results.
Submit another query.