DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and FSTL3

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_005851.1 Gene:FSTL3 / 10272 HGNCID:3973 Length:263 Species:Homo sapiens


Alignment Length:49 Identity:18/49 - (36%)
Similarity:26/49 - (53%) Gaps:8/49 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SCPCPRNYDP---VCGSDSVTYSNQCVL---DCLIKEGRSITVEKKGRC 68
            :.|||....|   :||:::|||.:.|.:   .|.:  ||||.|...|.|
Human   197 AAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFL--GRSIGVRHAGSC 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 17/47 (36%)
FSTL3NP_005851.1 KAZAL 120..167 CDD:197624
FOLN 170..193 CDD:128570
KAZAL_FS 200..243 CDD:238052 16/44 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..263 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.