DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31704 and Spink10

DIOPT Version :10

Sequence 1:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster
Sequence 2:XP_002728606.3 Gene:Spink10 / 100361300 RGDID:2320365 Length:160 Species:Rattus norvegicus


Alignment Length:39 Identity:13/39 - (33%)
Similarity:21/39 - (53%) Gaps:7/39 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CPRNYDPVCGSDSVTYSNQCVLDCLIKEGRSITVEKKGR 67
            |.|..:||||::..||.|:|:. |      :..:..||:
  Rat   124 CTREINPVCGTNGHTYDNECIF-C------NAMITSKGK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 13/39 (33%)
Spink10XP_002728606.3 KAZAL_FS 37..>71 CDD:412159
Kazal_1 114..157 CDD:395004 13/39 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.