DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tplus3a and RTF1

DIOPT Version :9

Sequence 1:NP_724373.1 Gene:tplus3a / 318904 FlyBaseID:FBgn0051702 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_011270.1 Gene:RTF1 / 852607 SGDID:S000003213 Length:558 Species:Saccharomyces cerevisiae


Alignment Length:417 Identity:79/417 - (18%)
Similarity:161/417 - (38%) Gaps:79/417 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DERLRTRRKIANKLESGGKTAHAFERLLAIRTIKLSKGKCSEDSAEQTKSSDDCKAQTRKDVNIE 66
            ||..|..|.......:.|.:.....:|..::..:..|.:...|:.::    ||.:....:|...:
Yeast   140 DEDSRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEDE----DDEEDYREEDYKDD 200

  Fly    67 VKETYSGDSSPN-----------SESENTAQNDPQMNVESEERVSNLEQLSRAVLKRNDIKNLLG 120
            ....|..|...|           .|.|...:.|.|   :.|..:|:..:|.   :.|:.:.....
Yeast   201 EGSEYGDDEEYNPFDRRDTYDKREEVEWAEEEDEQ---DREPEISDFNKLR---IGRSFVAKFCF 259

  Fly   121 KPIFAEAVIGSFVRINVG----KVYSIYETIALHQD--SKDYRVDGKRTNLTLVLRCGSEKRYSR 179
            .|.|.:||.|.:.|:|||    ...:.|..:.:.:.  .|.|.:....||....:..|.:::..:
Yeast   260 YPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQ 324

  Fly   180 IDVVSNQPITQKEFLLWLETNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDVEKLIQ-----D 239
            ::..|:....:.|:..:|.....::...|:|:.::.|..:|.:......|:...:::::     :
Yeast   325 MNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLTDKTTDEVVRHRMQFN 389

  Fly   240 KKEAG---------IKQNAAYRKISLIIERDMA---AGMNDVEK-VQVLEKKILEIDEEPRPQIE 291
            ||.:|         :::...|.| ....|:|:|   |.:.:.|| :.|.||.    .|..:..|:
Yeast   390 KKLSGTNAVLEKTVLREKLQYAK-ETNNEKDIAKYSAQLRNFEKRMSVYEKH----HENDQSDIK 449

  Fly   292 KSGQ----HRYQVLSSTRGV-HV---------------------PTIYRHELGVPSGGKSSFVKR 330
            |.|:    :|...:|:.|.. ||                     ..:|..|:......|:   |.
Yeast   450 KLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRLKTRTKVYYQEIQKEENAKA---KE 511

  Fly   331 TAKPEQHELEKYMRRKYKKSAVVSRSR 357
            .|:.|:.:.:|..:.|.:|..:|::.|
Yeast   512 IAQQEKLQEDKDAKDKREKELLVAQFR 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tplus3aNP_724373.1 Plus-3 105..198 CDD:281165 19/98 (19%)
RTF1NP_011270.1 COG5296 1..558 CDD:227615 79/417 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.