DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tplus3a and Rtf1

DIOPT Version :9

Sequence 1:NP_724373.1 Gene:tplus3a / 318904 FlyBaseID:FBgn0051702 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_006234845.1 Gene:Rtf1 / 366169 RGDID:1310654 Length:715 Species:Rattus norvegicus


Alignment Length:464 Identity:115/464 - (24%)
Similarity:207/464 - (44%) Gaps:84/464 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKIANKLESGGKTAHAFERLLAIRTIKLSKGKCSEDSAEQTKSSDDCKAQTRKDVN--------- 64
            :|...:::....|:|..||          :.|..|...:::::.::.||:..|..|         
  Rat   254 KKKLTQIQESQVTSHNKER----------RSKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKK 308

  Fly    65 --IEVKETYSGDSSPNSESENTAQNDPQMNV----ESEER---------VSNLEQLSRAVLKRND 114
              ::..|.||.|.....:.:::.::|.....    |.||:         ||..|:|:|..|.|:.
  Rat   309 QPLKTSEVYSDDEEEEDDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHK 373

  Fly   115 IKNLLGKPIFAEAVIGSFVRINVGK-----VYSIYETIALHQDSKDYRVDGKRTNLTLVLRCGSE 174
            ::.....|.||:.|.|.||||.:|.     ||.:.|...:.:.:|.|::.|.|||..|.||.|::
  Rat   374 LERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGND 438

  Fly   175 KRYSRIDVVSNQPITQKEFLLWLETNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDVEKLIQD 239
            :|..|::.||||..|:.||:.|.|........||||::|.||:..:|.|..|.:.:.|:|:::::
  Rat   439 QRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKEFSIKEALNYKFNDQDIEEIVKE 503

  Fly   240 KKE-AGIKQNAAYRKISLIIERDMAAGMNDVEKVQVLEKKILEIDEEPRPQIEKSGQHRYQVLSS 303
            |:. .....|.|.:|..|:.|:.||..:.|.:|.:.::.::.|::|            |.:.|..
  Rat   504 KERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLNELEE------------RAEALDR 556

  Fly   304 TRGVHVPTI-----YRHELGVPSGGKSSFVKRTAKPEQHELEKYMRRKYKKSAVVSRSRFKKAFE 363
            .|..::..|     ...|..:....| :.|..:......:::.:.||:.|.: :||.||      
  Rat   557 QRTKNISAISYINQRNREWNIVESEK-ALVAESHNMRNQQMDPFTRRQCKPT-IVSNSR------ 613

  Fly   364 DCVDSSAVVNDIHMESQQKEGD---VETETETETEKGTEKDLH----------LQRLHTFNIELD 415
                ..||...|..:...|.|.   .:...|....:|.:|||:          |.::|.|::::|
  Rat   614 ----DPAVQAAILAQLNAKYGSGALPDAPKEVSKGQGKDKDLNSKSASDLSEDLFKVHDFDVKID 674

  Fly   416 TTGLVPFHE 424
            ..  ||..|
  Rat   675 LQ--VPSSE 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tplus3aNP_724373.1 Plus-3 105..198 CDD:281165 37/97 (38%)
Rtf1XP_006234845.1 COG5296 194..628 CDD:227615 101/407 (25%)
Plus-3 364..464 CDD:397304 38/99 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340771
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.