DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tplus3a and CG12498

DIOPT Version :9

Sequence 1:NP_724373.1 Gene:tplus3a / 318904 FlyBaseID:FBgn0051702 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_570030.1 Gene:CG12498 / 31272 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster


Alignment Length:287 Identity:71/287 - (24%)
Similarity:119/287 - (41%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VKETYSGDSSP---NSESE---NTAQNDPQMNVESEERVSNLEQLSRAVLKRNDIKNLLGKPIFA 125
            |:|..:..:||   :.|:|   |..:..|..::.    |::.:||....|.|:.|..||.:|.|.
  Fly    17 VRELRNLRASPLRIDDENESWVNGYEKPPTPDLP----VTSRDQLELLRLSRHRIGLLLVRPAFE 77

  Fly   126 EAVIGSFVRINV---GKV--YSIYETIALHQDSKDYRVDGKRTNLTLVLRCGSEKRYSRIDVVSN 185
            :||.|.|||:||   |::  :.|.|.:.:.:....|:|:...||:.|.||....:....|:.|||
  Fly    78 QAVTGCFVRVNVSGQGELPDHRIAEVLGICELDFGYKVEQIPTNVALRLRYDDLEMQHEINDVSN 142

  Fly   186 QPITQKEFLLWLETNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDVEKLIQDKKEAGIKQNAA 250
            ...||:||.||.:..:....:.||.:.:.:|:|::.||.:.               ||       
  Fly   143 LNFTQEEFELWRDNCVNQAISPPTTHILTRKKVELYNALQL---------------EA------- 185

  Fly   251 YRKISLIIERDMAAGMNDVEKVQVLEKKILEIDEEPRPQIEKSGQHRYQVLSSTRGVHVPTIYRH 315
             :.:|| |:|..:..:...:|:.::|:                           .||..|....|
  Fly   186 -KPLSL-IQRTFSFALRPQQKIGIMER---------------------------HGVVYPWQLNH 221

  Fly   316 ELGV--------PSGGKSSFVKRTAKP 334
            .|..        ||.||:..|.....|
  Fly   222 SLPFVSQSPTENPSRGKADTVDEEEDP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tplus3aNP_724373.1 Plus-3 105..198 CDD:281165 36/97 (37%)
CG12498NP_570030.1 Plus3 51..157 CDD:197843 38/105 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449068
Domainoid 1 1.000 53 1.000 Domainoid score I4203
eggNOG 1 0.900 - - E1_COG5296
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.