DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tplus3a and SPBC651.09c

DIOPT Version :9

Sequence 1:NP_724373.1 Gene:tplus3a / 318904 FlyBaseID:FBgn0051702 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_595507.1 Gene:SPBC651.09c / 2541123 PomBaseID:SPBC651.09c Length:560 Species:Schizosaccharomyces pombe


Alignment Length:303 Identity:77/303 - (25%)
Similarity:136/303 - (44%) Gaps:29/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLRTRRKIANKLESGGKTAHAFERLLAIRTIKLS------KGKCSE-DSAEQTKSSDDCKAQTRK 61
            :|..||::|.:|........|.....:.|...|:      :.|.:| ....|.:|:.....:|||
pombe   110 KLMERRELAIRLHQQNAQYMAQSTRRSTRDKPLTSAAAGKRDKLTELKKRRQERSARSVSERTRK 174

  Fly    62 DVNIEVKETYSGDSSPNSESENTAQND---PQMNVESEERVS------NLEQLSRAVLKRNDIKN 117
            ...:       .|....:|||.:.:.:   |....|..|:||      ||..|:...|.|..:..
pombe   175 RSPV-------SDYEEQNESEKSEEEEGYSPSYAEEKVEQVSKDNASANLYDLNAIRLGRKHVAE 232

  Fly   118 LLGKPIFAEAVIGSFVRINVGK-----VYSIYETIALHQDSKDYRVDGKRTNLTLVLRCGSEKRY 177
            .:..|||...|.|.|||:.:|:     ||.:.:...:.:..|.|||||..|.::|....|..||.
pombe   233 YMYHPIFESTVTGCFVRVKIGERDGQGVYRLCQVKGILESRKPYRVDGVLTKVSLECFHGRSKRV 297

  Fly   178 SRIDVVSNQPITQKEFLLWLETNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDVEKLIQDKKE 242
            ..::|:||:|.:..:|..|....:.::.::|:.|.:.:|...:::..||..:|.:|..:|..|||
pombe   298 FDVNVLSNEPFSDHDFQRWHHQMMEDKLSMPSKNFVQRKLNDLRDMSKYVLSEKEVSDIINRKKE 362

  Fly   243 -AGIKQNAAYRKISLIIERDMAAGMNDVEKVQVLEKKILEIDE 284
             :.:..|.|..|..|...|..|....:.|.|:.::.::..::|
pombe   363 LSRVPSNIAAEKTRLRQRRQAAYVAGNAELVKEIDDQLNTLEE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tplus3aNP_724373.1 Plus-3 105..198 CDD:281165 31/97 (32%)
SPBC651.09cNP_595507.1 COG5296 1..560 CDD:227615 77/303 (25%)
Plus3 214..321 CDD:197843 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.