DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Prss36

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:248 Identity:92/248 - (37%)
Similarity:121/248 - (48%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGS---QP-EGFTV 78
            |..||  |||||.:......|:.|.|.|.|..|||||||:...|||||||...:   :| :..:|
Mouse    42 PEPSS--RIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSV 104

  Fly    79 HAGASRLDQEAPV----VRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPP 139
            ..|..  .|:.|:    :|:|.......:||......|:|||:|.....|.|    ::.|...|.
Mouse   105 LLGVH--SQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGP----SVRPVCLPR 163

  Fly   140 EGNAYAR-----ISGWGVTRENNREPAEQV-RTTMVRVLPGAECKISYSGYG------QLSDSML 192
            ..:.:|.     .:|||..:|....|...| :...:|:|..|.|:..||..|      ||...||
Mouse   164 ASHLFAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGML 228

  Fly   193 CAAV-RGLRDSCSGDSGGPLVY----RGQVCGIVSWGFGCARPSFPGVYTNVA 240
            ||.. .|.||:|.||||||||.    |..:.||.|:||||.|.:.|||:|.||
Mouse   229 CAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 89/241 (37%)
Tryp_SPc 26..251 CDD:238113 88/240 (37%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 88/240 (37%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.