DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:246 Identity:88/246 - (35%)
Similarity:127/246 - (51%) Gaps:21/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHC------VYGSQ 72
            |:.||::|. .:||||.......|||.|.|.......|||||||.:.|||||||      |...:
Mouse    13 AVALPANSD-DKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWVLSAAHCYKRRLQVRLGE 76

  Fly    73 PEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRN 137
            .....:..|...:|.| .::|:       |.|:....|.|:.|::|:...:|. .:|:|:|..|:
Mouse    77 HNIDVLEGGEQFIDAE-KIIRH-------PDYNKDTVDNDIMLIKLKSPAILN-SQVSTVSLPRS 132

  Fly   138 PPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRD 201
            ....||...:||||.|.....:....::.....||..:.||.||.  ||::.:|.|.. :.|.:|
Mouse   133 CASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYP--GQITSNMFCLGFLEGGKD 195

  Fly   202 SCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252
            ||.||||||:|..|::.||||||..||....|||||.|.:  ...:|::|:
Mouse   196 SCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCN--YLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 82/222 (37%)
Tryp_SPc 26..251 CDD:238113 83/231 (36%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 82/229 (36%)
Tryp_SPc 24..243 CDD:238113 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.