DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Klk10

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:272 Identity:74/272 - (27%)
Similarity:121/272 - (44%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLCHLALVLPSSSSKTRI-VGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYG 70
            ||  ...||:||.::::..: ..|.:......|:.|.|..|..|.|.|.|:....||:|||| :.
Mouse    29 LW--AAQALLLPGNATRVDLEASGAQCERDYHPWQVSLFHNLQFQCAGVLVDQNWVLTAAHC-WR 90

  Fly    71 SQPEGFTVHAGASRL---------DQEAPVVRNVVMFHTSPSYSA--------TNFDMDVALLQL 118
            ::|  .....|...|         ...:||      ||  |.|.|        .:.:.|:.:|:|
Mouse    91 NKP--LRARVGDDHLLLFQKEQLRSTSSPV------FH--PKYQACSGPILPHRSDEHDLMMLKL 145

  Fly   119 QEVVVLTPGKVATISP------CRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAEC 177
            ...|:||    :.:.|      |..|.:   ..::||||.:.....:....:..:.|.:|...:|
Mouse   146 SSPVMLT----SNVHPVQLPFRCSQPGQ---ECQVSGWGTSASRRVKYNRSLSCSKVTLLSQKQC 203

  Fly   178 KISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWG-FGCARPSFPGVYTNVAS 241
            :..|.|.  :::||:||...|.:|||..|||||||....:.|::||| :.|.....|.||:.:. 
Mouse   204 ETFYPGV--ITNSMICAEADGNQDSCQSDSGGPLVCDDTLHGVLSWGIYPCGAAQHPSVYSEIC- 265

  Fly   242 ERVHEFIEQTLR 253
             :...:|.:.:|
Mouse   266 -KYTPWIRRVIR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 66/240 (28%)
Tryp_SPc 26..251 CDD:238113 67/249 (27%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.