DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and prss1

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:243 Identity:87/243 - (35%)
Similarity:123/243 - (50%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYG 70
            :|..|..:|...|......:||||.|.|.:.|||.|.| .:||..|||||||:..|:||||| |.
Zfish     5 ILLALFAVAYAAPLGDDDDKIVGGYECTKNGVPYQVSL-NSGYHFCGGSLISNLWVVSAAHC-YK 67

  Fly    71 SQPE------GFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKV 129
            |:.:      ...|..|..:......|:|:       |||::...|.||.|::|.....:. ..|
Zfish    68 SRVQVRLGEHNIDVTEGTEQFINSEKVIRH-------PSYNSNTLDNDVMLIKLSSSAQIN-SYV 124

  Fly   130 ATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCA 194
            .|:|...:.........|||||....:......::......:|..:.|:.:|.  ||:|.:|.||
Zfish   125 KTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAYP--GQISSNMFCA 187

  Fly   195 A-VRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVAS 241
            . :.|.:|||.||||||:|...|:.||||||:|||:.:.||||..|.:
Zfish   188 GFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 83/222 (37%)
Tryp_SPc 26..251 CDD:238113 83/223 (37%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 83/224 (37%)
Tryp_SPc 25..243 CDD:238113 83/223 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.