DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG17242

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:243 Identity:70/243 - (28%)
Similarity:113/243 - (46%) Gaps:33/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQEAPVVR- 93
            |...|.:.|:...::.|....|||.:.|...:|:.|.||..::.|..:|..|:::.:....|:: 
  Fly    20 KSIGIEQAPWQASVQINDKHHCGGVIYSEDIILTIAECVRKARLEFISVRVGSAQENAGGTVLKV 84

  Fly    94 ---NVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPG----KVATISPCRNPPEGNAYARISGWG 151
               .:.:....||        |||:|||:..:.|..|    .:|||     |......|.:||||
  Fly    85 EKMRLQVLGLRPS--------DVAILQLRSPLYLDGGIRAIPLATI-----PLVPGTNASVSGWG 136

  Fly   152 VTRENNREPAEQVRTTM-VRVLPGAECKISYSGYGQL-SDSMLCAAVRG-LRDSCSGDSGGPLVY 213
            .....|  |:.:|...: |::.....|..:.:..|:| |...:|||..| :..:|.|..|||||.
  Fly   137 QLSAMN--PSSEVLLRVDVKIQDQLMCATNLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVA 199

  Fly   214 RGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLR-----RIG 256
            ..::.||:||...|...:...||.|:|..:|  :||.|::     |||
  Fly   200 NNRLYGILSWQSACDVLNKSSVYANIAMFKV--WIESTVKLMNFFRIG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 62/221 (28%)
Tryp_SPc 26..251 CDD:238113 66/231 (29%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 65/227 (29%)
Tryp_SPc 24..232 CDD:214473 63/224 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.