DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG34458

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:243 Identity:78/243 - (32%)
Similarity:118/243 - (48%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRL 85
            :.::||:||:.....:.|:.|.|:.||...|||||||...:::||||..|..|.......|.:.|
  Fly    27 AEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDL 91

  Fly    86 DQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPE--GNAYARIS 148
            ........|:..|...|.|:..:.|.|::|::|...|.: .|.|.||....:...  .:..|.||
  Fly    92 SAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPM-GGAVQTIQLADSDSNYAADTMAMIS 155

  Fly   149 GWGVTRENNREPAEQVRTTMVRV----------LPGAECKISYSGYGQLSDSMLCAA-VRGLRDS 202
            |:|...:|.:.| .:::...|::          :||            |:|.|:||. ..|...|
  Fly   156 GFGAINQNLQLP-NRLKFAQVQLWSRDYCNSQNIPG------------LTDRMVCAGHPSGQVSS 207

  Fly   203 CSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQ 250
            |.|||||||...|::.|:|||||||.....|.:||.|.:.|  .:|:|
  Fly   208 CQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALR--SWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 75/228 (33%)
Tryp_SPc 26..251 CDD:238113 77/238 (32%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 76/235 (32%)
Tryp_SPc 32..254 CDD:238113 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.