DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and AZU1

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:259 Identity:80/259 - (30%)
Similarity:110/259 - (42%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCHLALVLPS----SSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYG 70
            |..||.:|.|    ||....||||::....:.|:|..::..|...|||:||.:|.|::||.|...
Human     7 LALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQS 71

  Fly    71 SQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFD-----MDVALLQLQEVVVLTPGKVA 130
            ..|...||..||..|.:.....|..  |..| |.|...:|     .|:.||||.....||.....
Human    72 QNPGVSTVVLGAYDLRRRERQSRQT--FSIS-SMSENGYDPQQNLNDLMLLQLDREANLTSSVTI 133

  Fly   131 TISPCRNPP-EGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCA 194
            ...|.:|.. |.....:::|||..|...| .:...|...|.|.|..:|:          .:.:|.
Human   134 LPLPLQNATVEAGTRCQVAGWGSQRSGGR-LSRFPRFVNVTVTPEDQCR----------PNNVCT 187

  Fly   195 AVRGLRDS-CSGDSGGPLVYRGQVCGIVSWGFG-CARPSFPGVYTNVASERVHEFIEQTLRRIG 256
            .|...|.. |:||.|.|||..|...|:.|:..| |.|.  |..:|.||..|  ::|:..|...|
Human   188 GVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRG--PDFFTRVALFR--DWIDGVLNNPG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 68/223 (30%)
Tryp_SPc 26..251 CDD:238113 71/232 (31%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 70/230 (30%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.