DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and PRTN3

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:262 Identity:84/262 - (32%)
Similarity:115/262 - (43%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNG----YFICGGSLISSRAVLSAAHCVYGSQP 73
            |||:|..::....||||.|......||:..|:..|    :| |||:||....||:||||:.....
Human    15 LALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHF-CGGTLIHPSFVLTAAHCLRDIPQ 78

  Fly    74 EGFTVHAGASRLDQEAPV-----VRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATIS 133
            ....|..||..:..:.|.     |..|.:    .:|.|.|...||.|:||.....|: ..|||:.
Human    79 RLVNVVLGAHNVRTQEPTQQHFSVAQVFL----NNYDAENKLNDVLLIQLSSPANLS-ASVATVQ 138

  Fly   134 -PCRNPPEGNAYARIS-GWGVTRENNREPAEQV----RTTMVRVLPGAECKISYSGYGQLSDSML 192
             |.::.|..:....:: |||  |....:|..||    ..|:|...    |:          ...:
Human   139 LPQQDQPVPHGTQCLAMGWG--RVGAHDPPAQVLQELNVTVVTFF----CR----------PHNI 187

  Fly   193 CAAV-RGLRDSCSGDSGGPLVYRGQVCGI---VSWGFGCARPSFPGVYTNVASERVHEFIEQTLR 253
            |..| |.....|.|||||||:..|.:.||   |.|  |||...||..:|.||  ...::|..|||
Human   188 CTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIW--GCATRLFPDFFTRVA--LYVDWIRSTLR 248

  Fly   254 RI 255
            |:
Human   249 RV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 74/234 (32%)
Tryp_SPc 26..251 CDD:238113 76/243 (31%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.