DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and KLK10

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:258 Identity:76/258 - (29%)
Similarity:117/258 - (45%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLCHLALVLPSSSSKTRI---VGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYG 70
            |....|| ||.:.  ||:   ..|........|:.|.|.....|.|.|.|:....||:||||  |
Human    29 WAAEAAL-LPQND--TRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHC--G 88

  Fly    71 SQPEGFTVHAGASRL-----DQEAPVVRNVV--MFH--TSPSYSATNFDMDVALLQLQEVVVLTP 126
            ::|  .....|...|     :|.....|:||  .:|  :.|.......:.|:.||:|...|||.|
Human    89 NKP--LWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGP 151

  Fly   127 GKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSM 191
            ...|...|.|....|: ..:::|||.|.....:..:.:..:.:.:|...||::.|.|.  ::::|
Human   152 RVRALQLPYRCAQPGD-QCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGV--VTNNM 213

  Fly   192 LCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWG-FGCARPSFPGVYTNVASERVHEFIEQTLR 253
            :||.:...:|.|..|||||||....:.||:||| :.|.....|.|||.:.  :...:|.:.:|
Human   214 ICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQIC--KYMSWINKVIR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 68/228 (30%)
Tryp_SPc 26..251 CDD:238113 68/237 (29%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 68/231 (29%)
Tryp_SPc 49..269 CDD:214473 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.