DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Klk11

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:267 Identity:87/267 - (32%)
Similarity:127/267 - (47%) Gaps:37/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVY 69
            |::..|..||||......:|||:.|.|......|:.|.|.|....:||.:||:.:.:|:||||  
Mouse    27 RMILRLIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHC-- 89

  Fly    70 GSQPEGFTVHAGASRLDQ----EAPVVRNVVMFHTSPSYSATNFD--MDVALLQLQEVV------ 122
             .:|. :.:..|...|::    |...:......|...:.|..|.|  .|:.|:::...|      
Mouse    90 -RKPH-YVILLGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNKDHRNDIMLVKMSSPVFFTRAV 152

  Fly   123 ---VLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGY 184
               .|:|..||..:.|          .|||||.|..........:|...|.::...||:.:|.  
Mouse   153 QPLTLSPHCVAAGTSC----------LISGWGTTSSPQLRLPHSLRCANVSIIEHKECEKAYP-- 205

  Fly   185 GQLSDSMLCAAVR--GLRDSCSGDSGGPLVYRGQVCGIVSWGFG-CARPSFPGVYTNVASERVHE 246
            |.::|:||||:||  | :|||.||||||||..|.:.||:|||.. ||....|||||.|.  :...
Mouse   206 GNITDTMLCASVRKEG-KDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVC--KYFN 267

  Fly   247 FIEQTLR 253
            :|.:.:|
Mouse   268 WIHEVMR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 78/233 (33%)
Tryp_SPc 26..251 CDD:238113 78/242 (32%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 78/240 (33%)
Tryp_SPc 48..272 CDD:238113 78/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.