DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:262 Identity:88/262 - (33%)
Similarity:129/262 - (49%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWWLCHLALVLPSSSS---KTRIVGGKETTISEVPYLVYLRQ-NGYFICGGSLISSRAVLSAAH 66
            ||..||.|..:|..|..   :.|||||.......:.|:|.::. .|...|||:||:...||:|||
Zfish     4 LLLLLCVLLEILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLTAAH 68

  Fly    67 CVYGSQPEGFTVHAG--ASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLT---- 125
            |..|.  ....:.||  :..|.:.....|...|....|.|..:..:.|:.|::||..|.|.    
Zfish    69 CNIGE--ANMRIVAGDYSVGLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQSPVYLNSYVS 131

  Fly   126 ----PGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQ 186
                |.:.|.::..|       ...:||||.|.... ..:..:||..:.::..|.|..:.|..|.
Zfish   132 LVPLPRQDAMVAVGR-------LCSVSGWGFTTSTG-GISSILRTVKLPIVSTAVCNGTDSFNGN 188

  Fly   187 LSDSMLCAAV-RGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQ 250
            ::::|:||.. .|.:|:|.||||||||..|:|.||||||.|||...:|||||.|:..|  ::|:.
Zfish   189 ITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQFR--QWIDA 251

  Fly   251 TL 252
            |:
Zfish   252 TI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 78/227 (34%)
Tryp_SPc 26..251 CDD:238113 79/236 (33%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 79/234 (34%)
Tryp_SPc 27..252 CDD:238113 79/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.