DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and LOC560023

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:246 Identity:86/246 - (34%)
Similarity:131/246 - (53%) Gaps:24/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHC-- 67
            :|||....||:::..:.|: ||:||:|.....:.|.|.|:.:....|||:||..:.||:||||  
Zfish    24 QLLWVFLVLAVMVRDAFSQ-RIIGGQEVVPYSIKYQVSLQVDRKHFCGGTLIQPQWVLTAAHCWR 87

  Fly    68 ------VYGSQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTP 126
                  |..|: ....|..|..::...|.|..:|       :|:...|:.|:.:::|.....:..
Zfish    88 PASVIQVVLSE-HNLAVEEGFEQVCTVAKVFSHV-------AYNPKTFNNDIMIIKLTAPAQINA 144

  Fly   127 GKVATISPCRNPPE--GNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSD 189
            .....:.|..:.||  |.:...:|||||||..|...:..:|...|.:.  :.|::.|  |.:::|
Zfish   145 YVQPALLPTADTPELAGGSSCTVSGWGVTRLYNFYLSPILRAVDVEIF--SSCQLYY--YYRVND 205

  Fly   190 SMLCAAVR-GLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNV 239
            :|:||..| |.:|||.|||||||:..|.:.||||||.|||.|.:|||||.|
Zfish   206 NMICAGSRFGGKDSCQGDSGGPLICDGYLEGIVSWGIGCALPYYPGVYTKV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 80/226 (35%)
Tryp_SPc 26..251 CDD:238113 79/225 (35%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 80/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.