DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and Prss36

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:248 Identity:89/248 - (35%)
Similarity:122/248 - (49%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGS---QP-EGFTV 78
            |..||  |||||.:......|:.|.|...|..|||||||:...|||||||...:   :| :.::|
  Rat    53 PEPSS--RIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSV 115

  Fly    79 HAGASRLDQEAPV----VRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPP 139
            ..|..  .|:.|:    :|:|.......:||......|:|||:|.....|.|    ::.|...|.
  Rat   116 LLGVH--SQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGP----SVKPVCLPR 174

  Fly   140 EGNAYAR-----ISGWGVTRENNREPAEQV-RTTMVRVLPGAECKISYSGYG------QLSDSML 192
            ..:.:|.     .:|||..:|::..|...| :...:::|....|:..||..|      ||...||
  Rat   175 ASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGML 239

  Fly   193 CAAV-RGLRDSCSGDSGGPLVY----RGQVCGIVSWGFGCARPSFPGVYTNVA 240
            ||.. .|.||:|.||||||||.    |..:.||.|:||||.|.:.|||:|.||
  Rat   240 CAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 86/241 (36%)
Tryp_SPc 26..251 CDD:238113 85/240 (35%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 85/240 (35%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.