DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and try10

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:244 Identity:95/244 - (38%)
Similarity:129/244 - (52%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYG 70
            ||:.|..||:..|.... .:||||...:   |||.|.|.. ||..||||||:...|:||||| |.
 Frog     5 LLFSLLGLAVAQPIEDD-DKIVGGYHCS---VPYQVSLNA-GYHFCGGSLINEHWVVSAAHC-YQ 63

  Fly    71 SQPE------GFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKV 129
            |:.|      ...:..|..:..|.|.::|:       |.|::...|.|:.|:||||...|. .:|
 Frog    64 SKMELRIGENNIELLEGTEQFIQSAKIIRH-------PQYNSWTIDNDIMLIQLQEPAQLN-NEV 120

  Fly   130 ATIS-PCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLC 193
            ..|. |...||.| :...|||||.|..|.....:.::.....:|...||:.||.  |.::|:|:|
 Frog   121 QPIPLPTECPPVG-SICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQSYP--GSITDNMIC 182

  Fly   194 AA-VRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVAS 241
            .. :.|..|||.||||||:|..|::.|:||||.|||.|.:|||||.|.:
 Frog   183 VGYLEGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPGYPGVYTKVCN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 89/223 (40%)
Tryp_SPc 26..251 CDD:238113 89/224 (40%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 89/224 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.