DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG34130

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:262 Identity:68/262 - (25%)
Similarity:116/262 - (44%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WWLCHLALVLPSSSSKT-------RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAA 65
            ||....:.:......:|       |..||     ..||:|:.:.....|:||.|.:|:...|::|
  Fly    24 WWNSSASYLHGRPPVRTLNKNGIRRTSGG-----HAVPWLLRIVDGPTFVCGASYLSALYALTSA 83

  Fly    66 HCVYG--SQPEGFTVHAGAS------RLDQEAP---VVRNVVM---FHTSPSYSATNFDMDVALL 116
            :|::.  ||.|..:|...:|      :||...|   ::||:::   :|...::      ||||::
  Fly    84 NCMHSHRSQMESLSVELVSSDSRQDNQLDSHDPPNALIRNIIVSKDWHWPGTF------MDVAVI 142

  Fly   117 QLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISY 181
            :|...:........|:  |.||........:..:|.      .|||.|||..:.||....|..:|
  Fly   143 ELTNRLRGNRNNYVTL--CTNPLSSYKSLSVVSYGA------GPAENVRTEEIEVLNRMICDSAY 199

  Fly   182 SGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHE 246
            ..: .|.:::.||........|...:|.|:....|:||||:|...|.|.:.||::|::  .:|..
  Fly   200 GNF-LLRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDI--HQVKR 261

  Fly   247 FI 248
            ||
  Fly   262 FI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 62/229 (27%)
Tryp_SPc 26..251 CDD:238113 64/237 (27%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 60/226 (27%)
Tryp_SPc 53..256 CDD:304450 59/217 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.