DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and intr

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:240 Identity:58/240 - (24%)
Similarity:103/240 - (42%) Gaps:41/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLPSSSSKTRIVGGKETTISEVP-----YLVYLRQNGYFICGGSLISSRAVLSAAHC----VYGS 71
            ::| :..:|.:..|:.||  |.|     :::.:......||.|:|||:|.||::|.|    :...
  Fly    76 IIP-AEIETLLTDGQATT--EAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQP 137

  Fly    72 QPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCR 136
            .|..:.:.|..||:...|.::...:              .|:|||.|.  ..|....|..|..|.
  Fly   138 PPRSYKLQASRSRIYSVANLITGAI--------------EDMALLLLH--APLEDPFVHPIDLCE 186

  Fly   137 NPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYS--GYGQLSDSMLCAAVRGL 199
            :|...|.       .||...:::....:||   :::|.:.||.||:  ....::.:||||.....
  Fly   187 SPLRRND-------NVTMYMSQQHLRFLRT---KLIPNSNCKRSYAQDENAFITQTMLCALNSNR 241

  Fly   200 RDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPG-VYTNVASER 243
            ...|....|..|:::.::||:..:|..|:.....| :|.:|...|
  Fly   242 LVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVFKAR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 55/227 (24%)
Tryp_SPc 26..251 CDD:238113 56/230 (24%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 50/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.