DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG15498

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:101 Identity:21/101 - (20%)
Similarity:36/101 - (35%) Gaps:25/101 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCHLALV---LPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGS 71
            :|.|.:.   .|:..:..|||...|..           :.|.::..|.....:|:..|...:|  
  Fly   105 MCDLTVAPSPRPALRNSFRIVSPNEDD-----------RTGQYLAYGEKFRLQALEPADEPMY-- 156

  Fly    72 QPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSAT 107
                  |.:|..||:...||.:   .|.|:.:...|
  Fly   157 ------VFSGPKRLNLSLPVEK---AFFTTKNGEVT 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 18/83 (22%)
Tryp_SPc 26..251 CDD:238113 17/82 (21%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.