DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33159 and CG5255

DIOPT Version :9

Sequence 1:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:256 Identity:70/256 - (27%)
Similarity:119/256 - (46%) Gaps:39/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVLPSSSSKTRIVGGKETTISEVPYLVYLR--QNGYFICGGSLISSRAVLSAAHCVYGSQPEGFT 77
            ::.|...:|.|||||:|......||.:.|:  .:|...|||::|..|.:::||||..|.|...|.
  Fly    19 ILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFR 83

  Fly    78 VHAGASRLDQEAP--VVRNVVMFHTSPSYSATNFDMDVALLQLQEVVV--------------LTP 126
            |..|...|.|...  ...:.::.|:  :|:...:..|:|||.|.|.:|              |.|
  Fly    84 VLTGTQDLHQNGSKYYYPDRIVEHS--NYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVP 146

  Fly   127 GKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSM 191
            |               :...::|||........|| ::::..|..:|..:|:.::....::....
  Fly   147 G---------------SRLLLTGWGTLSLGGDVPA-RLQSLEVNYVPFEQCRAAHDNSTRVDIGH 195

  Fly   192 LCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252
            :|......|.:|.||||||||:.|::..:|:||..||: .:|..:.:::  ..|:||...|
  Fly   196 VCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAK-GYPDAHASIS--YYHDFIRTHL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 64/233 (27%)
Tryp_SPc 26..251 CDD:238113 66/242 (27%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 65/240 (27%)
Tryp_SPc 30..252 CDD:238113 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.